Toxoplasma gondii P24 (GRA1) recombinant antigen

Toxoplasma gongii GRA1Antigen
Catalog Number: 00207-V
Product Description: E. coli recombinant containing GRA1 immunodominant region.
Fusions C-terminal six histidines.
Origin: E. coli
Purity: >90% pure; Purity: of proteins is evaluated by SDS-PAGE
Buffer/Composition: 1XPBS pH 7.2; 50% glycerol
Concentration: 1 mg/ml; bulk amount available upon request
Storage: Long Term: -80˚C
Short Term: 4˚C (Three month or less)
Application: ELISA, WB, Flow-Through
Shipping: Cold pack
Comments Reactive with sera from Toxoplasma gondii infected individuals with minimum specificity problems.
The products are for laboratory research use or further manufacturing only and should not be used for human therapeutic or diagnostic applications.

MGAYAAEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTG
NPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQ
AEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGEREHHHHH
H